PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.2735s0030.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 386aa    MW: 43038.8 Da    PI: 4.4812
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.2735s0030.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.74.7e-53111381128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                             lp GfrF+P+d elv++yLk k++g++ ++ +vi+e+d++k+ePwdLp  + +++e+ ew+fF++ d+ky++g+r+nrat++gyWka
  SapurV1A.2735s0030.4.p  11 LPLGFRFRPSDAELVNYYLKYKINGRDDKV-KVIREIDVCKWEPWDLPglSIIENEDPEWFFFCPLDRKYPNGSRQNRATSAGYWKA 96 
                             699************************999.99***************6336777888***************************** PP

                     NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             tgkd++++s +++l+g+kktLvfy+grapkg++t+Wvmheyr 
  SapurV1A.2735s0030.4.p  97 TGKDRKIKS-GQSLIGMKKTLVFYTGRAPKGKRTNWVMHEYRT 138
                             *********.999****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-605161IPR003441NAC domain
PROSITE profilePS5100556.45211161IPR003441NAC domain
PfamPF023651.6E-2712137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MAVLSLNLNS LPLGFRFRPS DAELVNYYLK YKINGRDDKV KVIREIDVCK WEPWDLPGLS  60
IIENEDPEWF FFCPLDRKYP NGSRQNRATS AGYWKATGKD RKIKSGQSLI GMKKTLVFYT  120
GRAPKGKRTN WVMHEYRTTE EEFDGTKPGQ SAFVLCRLFK KQDESIERPN SDEAETTVSS  180
PTTALSSPEV TQSDQLLTEA SPQNATISGV VAPVEFPSCS VGVSDGGDQT VDLPASPEEE  240
LNLEDALNWL FDSPPKAHYE LFPPVHEQVQ EALGSSSMFY HGNNELSSSN RGMQSHNGGN  300
ETDADTTEFI NSILEQPDEH LYEVPSVQDI SSFPSESLFS GSLLNVVNDT ESYSGSDFDL  360
EQIRVSGKCH ISSAYHIFLH ILELI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-471016516169NAC domain-containing protein 19
4dul_A2e-471016516169NAC domain-containing protein 19
1ut7_B2e-471016516169NO APICAL MERISTEM PROTEIN
1ut7_A2e-471016516169NO APICAL MERISTEM PROTEIN
1ut4_B2e-471016516169NO APICAL MERISTEM PROTEIN
1ut4_A2e-471016516169NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002317831.20.0hypothetical protein POPTR_0012s00760g
SwissprotQ9LKG81e-98NAC91_ARATH; NAC domain-containing protein 91
TrEMBLB9I2820.0B9I282_POPTR; Uncharacterized protein
STRINGPOPTR_0012s00760.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24590.21e-100TCV-interacting protein